Recombinant Human ITGB1 protein

• Cat.No.: ITGB1-26860TH
• Product Overview: Recombinant Human ITGB1 was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 88.4 kDa
• AA Sequence: MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGC PPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMD LSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSL TNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAY NSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGF TEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEIC SNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVES RDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLI WKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK
• Applications: Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet.
• Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ITGB1 integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) [ Homo sapiens ]
• Official Symbol: ITGB1
• Synonyms: ITGB1; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); FNRB, MDF2, MSK12; integrin beta-1; CD29; GPIIA; integrin VLA-4 beta subunit; very late activation protein, beta polypeptide; FNRB; MDF2; VLAB; MSK12; VLA-BETA
• Gene ID: 3688
• mRNA Refseq: NM_002211
• Protein Refseq: NP_002202
• MIM: 135630
• UniProt ID: P05556
• Chromosome Location: 10p11.2
• Pathway: Adaptive Immune System, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem
• Function: actin binding; alpha-actinin binding; collagen binding; fibronectin binding; glycoprotein binding; integrin binding; laminin binding; peptide binding; protease binding; protein binding; protein domain specific binding; protein heterodimerization activity; protein kinase binding; receptor activity