Recombinant Human ITGA6 Protein, N-His6ABP tagged

• Cat.No.: ITGA6-06H
• Product Overview: Recombinant Human ITGA6 Protein with N-His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&ABP
• Description: The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 32 kDa including tags
• AA Sequence: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Applications: Blocking agent and positive assay control using corresponding antibodies.
• Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
• Storage: Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS and 1M Urea, pH 7.4.
• Shipping: Shipped in liquid form on wet ice.

Gene Information

• Gene Name: ITGA6 integrin, alpha 6 [ Homo sapiens (human) ]
• Official Symbol: ITGA6
• Synonyms: ITGA6; integrin, alpha 6; integrin alpha-6; CD49f; integrin alpha6B; CD49 antigen-like family member F; VLA-6; ITGA6B; FLJ18737; DKFZp686J01244
• Gene ID: 3655
• mRNA Refseq: NM_000210
• Protein Refseq: NP_000201
• MIM: 147556
• UniProt ID: P23229