Recombinant Human ITGA6 protein(621-730 aa), C-His-tagged

• Cat.No.: ITGA6-2700H
• Product Overview: Recombinant Human ITGA6 protein(P23229)(621-730 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 621-730 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: ITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ITGA6 integrin, alpha 6 [ Homo sapiens ]
• Official Symbol: ITGA6
• Synonyms: ITGA6; integrin, alpha 6; integrin alpha-6; CD49f; integrin alpha6B; CD49 antigen-like family member F; VLA-6; ITGA6B; FLJ18737; DKFZp686J01244
• Gene ID: 3655
• mRNA Refseq: NM_000210
• Protein Refseq: NP_000201
• MIM: 147556
• UniProt ID: P23229