Recombinant Human ISOC2 Protein, GST-tagged

• Cat.No.: ISOC2-5010H
• Product Overview: Human ISOC2 full-length ORF ( AAH17344.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ISOC2 (Isochorismatase Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is ISOC1.
• Molecular Mass: 48.7 kDa
• AA Sequence: MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQYPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIKEPAPDSGLLGLFQGQNSLLH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ISOC2 isochorismatase domain containing 2 [ Homo sapiens ]
• Official Symbol: ISOC2
• Synonyms: ISOC2; isochorismatase domain containing 2; isochorismatase domain-containing protein 2, mitochondrial; FLJ23469; FLJ18582
• Gene ID: 79763
• mRNA Refseq: NM_001136201
• Protein Refseq: NP_001129673
• MIM: 612928
• UniProt ID: Q96AB3