Recombinant Human ISL2 Protein, GST-tagged

• Cat.No.: ISL2-5013H
• Product Overview: Human ISL2 full-length ORF ( NP_665804.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ISL2 (ISL LIM Homeobox 2) is a Protein Coding gene. Among its related pathways are Neural Stem Cell Differentiation Pathways and Lineage-specific Markers. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is ISL1.
• Molecular Mass: 66.2 kDa
• AA Sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ISL2 ISL LIM homeobox 2 [ Homo sapiens ]
• Official Symbol: ISL2
• Synonyms: ISL2; ISL LIM homeobox 2; ISL2 transcription factor, LIM/homeodomain, (islet 2); insulin gene enhancer protein ISL-2; FLJ10160; islet-2; ISL2 transcription factor, LIM/homeodomain, (islet-2)
• Gene ID: 64843
• mRNA Refseq: NM_145805
• Protein Refseq: NP_665804
• MIM: 609481
• UniProt ID: Q96A47