Recombinant Human ISG15, StrepII-tagged

• Cat.No.: ISG15-258H
• Product Overview: Purified, full-length human recombinant ISG15 or Ubiquitin-like protein (amino acids 2-157, 156 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17 kDa. (Accession NP_005092.1; UniProt P05161)

Specification

• Description: ISG15 is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 2-157, 156 a.a.
• AA Sequence: GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVD KCDEPLSILVRNNKG
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: ISG15 ISG15 ubiquitin-like modifier [ Homo sapiens ]
• Official Symbol: ISG15
• Synonyms: ISG15; ISG15 ubiquitin-like modifier; G1P2, interferon, alpha inducible protein (clone IFI 15K); ubiquitin-like protein ISG15; IFI15; UCRP; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 17 kDa protein; interferon-stimulated protein, 15 kDa; interferon-induced 17-kDa/15-kDa protein; interferon, alpha-inducible protein (clone IFI-15K); G1P2; IP17; hUCRP
• Gene ID: 9636
• mRNA Refseq: NM_005101
• Protein Refseq: NP_005092
• MIM: 147571
• UniProt ID: P05161
• Chromosome Location: 1p36.33
• Pathway: Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem
• Function: protein tag