Recombinant Human IRS1 protein(831-900 aa), C-His-tagged

• Cat.No.: IRS1-2738H
• Product Overview: Recombinant Human IRS1 protein(P35568)(831-900 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 831-900 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HPHHQVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE

Gene Information

• Gene Name: IRS1 insulin receptor substrate 1 [ Homo sapiens ]
• Official Symbol: IRS1
• Synonyms: IRS1; insulin receptor substrate 1; HIRS 1; IRS-1; HIRS-1
• Gene ID: 3667
• mRNA Refseq: NM_005544
• Protein Refseq: NP_005535
• UniProt ID: P35568