Recombinant Human IRF6

• Cat.No.: IRF6-28727TH
• Product Overview: Recombinant fragment of Human IRF6 with N-terminal proprietary tag. Predicted MW 36.63kDa.

Specification

• Description: This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in normal mammary epithelial cells. Expression is reduced or absent in breast carcinomas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ
• Sequence Similarities: Belongs to the IRF family.Contains 1 IRF tryptophan pentad repeat DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: IRF6 interferon regulatory factor 6 [ Homo sapiens ]
• Official Symbol: IRF6
• Synonyms: IRF6; interferon regulatory factor 6; LPS, Van der Woude syndrome , VWS; OFC6; VWS1
• Gene ID: 3664
• mRNA Refseq: NM_001206696
• Protein Refseq: NP_001193625
• MIM: 607199
• Uniprot ID: O14896
• Chromosome Location: 1q32.2-q32.3
• Pathway: Apoptosis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem
• Function: DNA binding; protein binding; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity