Recombinant Human IRF6

Cat.No. : IRF6-28727TH
Product Overview : Recombinant fragment of Human IRF6 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in normal mammary epithelial cells. Expression is reduced or absent in breast carcinomas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ
Sequence Similarities : Belongs to the IRF family.Contains 1 IRF tryptophan pentad repeat DNA-binding domain.
Gene Name IRF6 interferon regulatory factor 6 [ Homo sapiens ]
Official Symbol IRF6
Synonyms IRF6; interferon regulatory factor 6; LPS, Van der Woude syndrome , VWS; OFC6; VWS1;
Gene ID 3664
mRNA Refseq NM_001206696
Protein Refseq NP_001193625
MIM 607199
Uniprot ID O14896
Chromosome Location 1q32.2-q32.3
Pathway Apoptosis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem;
Function DNA binding; protein binding; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IRF6 Products

Required fields are marked with *

My Review for All IRF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon