Recombinant Human IQCH Protein, GST-tagged

• Cat.No.: IQCH-4237H
• Product Overview: Human FLJ12476 partial ORF ( NP_073621, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: IQCH (IQ Motif Containing H) is a Protein Coding gene.
• Molecular Mass: 36.74 kDa
• AA Sequence: LSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IQCH IQ motif containing H [ Homo sapiens ]
• Official Symbol: IQCH
• Synonyms: IQCH; IQ motif containing H; IQ domain-containing protein H; FLJ12476; testis development protein NYD-SP5; NYDSP5; DKFZp434F2114
• Gene ID: 64799
• mRNA Refseq: NM_001031715
• Protein Refseq: NP_001026885
• MIM: 612523
• UniProt ID: Q86VS3