Recombinant Human IPO8 Protein, GST-tagged

• Cat.No.: IPO8-5075H
• Product Overview: Human IPO8 partial ORF ( NP_006381.2, 949 a.a. - 1037 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq
• Molecular Mass: 35.53 kDa
• AA Sequence: LDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IPO8 importin 8 [ Homo sapiens ]
• Official Symbol: IPO8
• Synonyms: IPO8; importin 8; RAN binding protein 8 , RANBP8; importin-8; IMP8; imp8; RAN binding protein 8; ran-binding protein 8; RANBP8; FLJ21954; FLJ26580
• Gene ID: 10526
• mRNA Refseq: NM_001190995
• Protein Refseq: NP_001177924
• MIM: 605600
• UniProt ID: O15397