Recombinant Human IPO7 protein, GST-tagged

• Cat.No.: IPO7-3676H
• Product Overview: Recombinant Human IPO7 protein(879-1016 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 879-1016 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IPO7 importin 7 [ Homo sapiens ]
• Official Symbol: IPO7
• Synonyms: IPO7; importin 7; RAN binding protein 7 , RANBP7; importin-7; Imp7; RAN-binding protein 7; RANBP7; FLJ14581; MGC138673
• Gene ID: 10527
• mRNA Refseq: NM_006391
• Protein Refseq: NP_006382
• MIM: 605586
• UniProt ID: O95373