Recombinant Human interleukin 21 Protein, Tag Free, Animal Free

• Cat.No.: IL21-05H
• Product Overview: Recombinant human IL-21 (30-162aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques. Produced using non-animal reagents in an animal-free laboratory.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 30-162aa
• Description: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Tag: Non
• Form: Liquid
• Bio-activity: The activity is determined by the IFN-γ ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 4 ng/mL.
• Molecular Mass: 15.5 kDa
• AA Sequence: MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4)
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• References: 1. Gui G., et al. (2017) Clin Immunol. 183:266-272.
  2. Parrish-Novak J., et al. (2000) Nature. 408(6808):57-63.

Gene Information

• Gene Name: IL21 interleukin 21 [ Homo sapiens (human) ]
• Official Symbol: IL21
• Synonyms: IL21; interleukin 21; Za11; IL-21; CVID11; interleukin-21
• Gene ID: 59067
• mRNA Refseq: NM_021803
• Protein Refseq: NP_068575
• MIM: 605384
• UniProt ID: Q9HBE4