Recombinant Human Interleukin 12 Protein, His tagged
Cat.No. : | IL12-22H |
Product Overview : | Recombinant human IL12 protein, fused to His-tag at Cterminus, was expressed in insect cells using baculovirus expression system and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Baculovirus |
Tag : | His |
Protein Length : | 23-328aa(p40)/23-219aa(p35) |
Description : | IL12 is a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. It is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit and a 35 kD subunit. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. IL12 has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. |
Tag : | C-His |
Form : | Liquid |
Bio-activity : | The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤1 ng/mL. |
Molecular Mass : | 57.9 kDa |
AA Sequence : | IL12B (p40): IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS IL12A (p35): RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
GeneID 2 : | 3592 |
Gene Name | IL12B interleukin 12B [ Homo sapiens (human) ] |
Official Symbol | IL12B |
Synonyms | IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B; |
Gene ID | 3593 |
mRNA Refseq | NM_002187 |
Protein Refseq | NP_002178 |
MIM | 161561 |
UniProt ID | P29460 |
Gene Name 2 | IL12A interleukin 12A [ Homo sapiens (human) ] |
Official Symbol 2 | IL12A |
Synonyms 2 | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
mRNA Refseq 2 | NM_000882 |
Protein Refseq 2 | NP_000873 |
MIM 2 | 161560 |
UniProt ID 2 | P29459 |
◆ Recombinant Proteins | ||
IL12-417H | Active Recombinant Human IL12 protein | +Inquiry |
IL12-001H | Active Recombinant Human IL12, HIgG1 Fc-tagged | +Inquiry |
IL12-001M | Active Recombinant Mouse IL12, HIgG1 Fc-tagged, mutant | +Inquiry |
IL12-22H | Recombinant Human Interleukin 12 Protein, His tagged | +Inquiry |
IL12-26R | Recombinant Rat IL12 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *
0
Inquiry Basket