Recombinant Human INSR Protein, His-SUMO-tagged
| Cat.No. : | INSR-1260H |
| Product Overview : | Recombinant Human INSR Protein (1023-1298aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Protein length : | 1023-1298 a.a. |
| Gene Name | INSR insulin receptor [Homo sapiens] |
| Official Symbol | INSR |
| Synonyms | INSR; insulin receptor; HHF5; CD220; EC 2.7.10.1; IR; CD220 antigen; Insulin receptor subunit alpha; Insulin receptor subunit beta |
| Gene ID | 3643 |
| mRNA Refseq | NM_000208 |
| Protein Refseq | NP_000199 |
| MIM | 147670 |
| UniProt ID | P06213 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INSR Products
Required fields are marked with *
My Review for All INSR Products
Required fields are marked with *
0
Inquiry Basket
