Recombinant Human INSR Protein, His-SUMO-tagged
Cat.No. : | INSR-1260H |
Product Overview : | Recombinant Human INSR Protein (1023-1298aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1023-1298 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | INSR insulin receptor [Homo sapiens] |
Official Symbol | INSR |
Synonyms | INSR; insulin receptor; HHF5; CD220; EC 2.7.10.1; IR; CD220 antigen; Insulin receptor subunit alpha; Insulin receptor subunit beta |
Gene ID | 3643 |
mRNA Refseq | NM_000208 |
Protein Refseq | NP_000199 |
MIM | 147670 |
UniProt ID | P06213 |
◆ Recombinant Proteins | ||
INSR-1605R | Recombinant Monkey INSR Protein, hIgG1-tagged | +Inquiry |
INSR-5093H | Active Recombinant Human INSR Protein, GST-tagged | +Inquiry |
INSR-623H | Recombinant Human INSR, His tagged | +Inquiry |
INSR-216H | Recombinant Human INSR protein, DDK/His-tagged | +Inquiry |
Insr-7896R | Recombinant Rat Insr protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSR-474HCL | Recombinant Human INSR cell lysate | +Inquiry |
INSR-2648HCL | Recombinant Human INSR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INSR Products
Required fields are marked with *
My Review for All INSR Products
Required fields are marked with *
0
Inquiry Basket