Recombinant Human INSR Protein, GST-tagged

• Cat.No.: INSR-5092H
• Product Overview: Human INSR partial ORF ( NP_000199, 881 a.a. - 980 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: After removal of the precursor signal peptide, the insulin receptor precursor is post-translationally cleaved into two chains (alpha and beta) that are covalently linked. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: IVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INSR insulin receptor [ Homo sapiens ]
• Official Symbol: INSR
• Synonyms: INSR; insulin receptor; CD220; IR; HHF5
• Gene ID: 3643
• mRNA Refseq: NM_000208
• Protein Refseq: NP_000199
• MIM: 147670
• UniProt ID: P06213