Recombinant Human INSR protein(601-750 aa), C-hFc & C-His-tagged
| Cat.No. : | INSR-2566H |
| Product Overview : | Recombinant Human INSR protein(P06213)(601-750 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | HEK293 |
| Species : | Human |
| Tag : | C-hFc & C-His |
| Protein length : | 601-750 aa |
| Form : | 0.15 M Phosphate buffered saline |
| AASequence : | DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGT |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | INSR insulin receptor [ Homo sapiens ] |
| Official Symbol | INSR |
| Synonyms | INSR; insulin receptor; CD220; IR; HHF5; |
| Gene ID | 3643 |
| mRNA Refseq | NM_000208 |
| Protein Refseq | NP_000199 |
| MIM | 147670 |
| UniProt ID | P06213 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INSR Products
Required fields are marked with *
My Review for All INSR Products
Required fields are marked with *
0
Inquiry Basket
