Recombinant Human INS therapeutic protein

Cat.No. : INS-P040H
Product Overview : Recombinant Human INS therapeutic protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 30 aa
Description : The expression product is the active ingredient of Novolin R.
Molecular Mass : 5.8 kDa
AA Sequence : FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name INS insulin [ Homo sapiens ]
Official Symbol INS
Synonyms INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID 3630
mRNA Refseq NM_000207
Protein Refseq NP_000198
UniProt ID P01308
Chromosome Location 11p15.5
Pathway ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All INS Products

Required fields are marked with *

My Review for All INS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon