Recombinant Human ING3 protein, GST-tagged

• Cat.No.: ING3-301316H
• Product Overview: Recombinant Human ING3 (1-92 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Phe92
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ING3 inhibitor of growth family, member 3 [ Homo sapiens ]
• Official Symbol: ING3
• Synonyms: ING3; inhibitor of growth family, member 3; inhibitor of growth protein 3; Eaf4; FLJ20089; MEAF4; p47ING3; ING2
• Gene ID: 54556
• mRNA Refseq: NM_019071
• Protein Refseq: NP_061944
• MIM: 607493
• UniProt ID: Q9NXR8