Recombinant Human IMPG2 Protein, GST-tagged

• Cat.No.: IMPG2-5137H
• Product Overview: Human IMPG2 partial ORF ( NP_057331.2, 572 a.a. - 678 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM
• Molecular Mass: 37.51 kDa
• AA Sequence: LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IMPG2 interphotoreceptor matrix proteoglycan 2 [ Homo sapiens (human) ]
• Official Symbol: IMPG2
• Synonyms: IMPG2; interphotoreceptor matrix proteoglycan 2; RP56; VMD5; IPM200; SPACRCAN; interphotoreceptor matrix proteoglycan 2; IPM 200; interphotoreceptor matrix proteoglycan IPM 200; interphotoreceptor matrix proteoglycan of 200 kDa; sialoprotein associated with cones and rods proteoglycan
• Gene ID: 50939
• mRNA Refseq: NM_016247
• Protein Refseq: NP_057331
• MIM: 607056
• UniProt ID: Q9BZV3