Recombinant Human Immunodeficiency Virus Type 1 Group M Subtype K VPR Protein (1-96 aa), His-Myc-tagged
Cat.No. : | VPR-2687H |
Product Overview : | Recombinant Human Immunodeficiency Virus Type 1 Group M Subtype K (isolate 96CM-MP535) (HIV-1) VPR Protein (1-96 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Immunodeficiency Virus Type 1 Group M Subtype K |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-96 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.8 kDa |
AA Sequence : | MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | vpr Vpr [ Human immunodeficiency virus 1 ] |
Official Symbol | VPR |
Synonyms | vpr; |
Gene ID | 155807 |
UniProt ID | P0C1P2 |
◆ Recombinant Proteins | ||
VPR-0801B | Recombinant Bacillus subtilis VPR protein, His-tagged | +Inquiry |
Vpr-3149 | Recombinant Vpr protein, His-tagged | +Inquiry |
VPR-2687H | Recombinant Human Immunodeficiency Virus Type 1 Group M Subtype K VPR Protein (1-96 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPR Products
Required fields are marked with *
My Review for All VPR Products
Required fields are marked with *
0
Inquiry Basket