Recombinant Human ILVBL Full Length Transmembrane protein, His-tagged
Cat.No. : | ILVBL-1316H |
Product Overview : | Recombinant Human ILVBL protein(A1L0T0)(1-632aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-632aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.7 kDa |
AA Sequence : | METPAAAAPAGSLFPSFLLLACGTLVAALLGAAHRLGLFYQLLHKVDKASVRHGGENVAA VLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAV TAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVR RVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWY LENYLANLFAGAWEPQPEGPLPLDIPQASPQQVQRCVEILSRAKRPLMVLGSQALLTPTS ADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLAGTVCDFRLSY GRVLSHSSKIIIVNRNREEMLLNSDIFWKPQEAVQGDVGSFVLKLVEGLQGQTWAPDWVE ELREADRQKEQTFREKAAMPVAQHLNPVQVLQLVEETLPDNSILVVDGGDFVGTAAHLVQ PRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIP VMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVKV LHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ILVBL ilvB (bacterial acetolactate synthase)-like [ Homo sapiens ] |
Official Symbol | ILVBL |
Synonyms | ILVBL; ilvB (bacterial acetolactate synthase)-like; acetolactate synthase-like protein; 209L8; acetolactate synthase homolog; AHAS; FLJ39061; ILV2H; MGC1269; MGC19535; ilvB-like protein; |
Gene ID | 10994 |
mRNA Refseq | NM_006844 |
Protein Refseq | NP_006835 |
MIM | 605770 |
UniProt ID | A1L0T0 |
◆ Recombinant Proteins | ||
Angptl6-1454M | Recombinant Mouse Angptl6 protein, His-tagged | +Inquiry |
RFL6213DF | Recombinant Full Length Danio Rerio Mitoferrin-2(Slc25A28) Protein, His-Tagged | +Inquiry |
WFIKKN1-6245R | Recombinant Rat WFIKKN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSTM1-501H | Recombinant Human VSTM1 Protein, His-tagged | +Inquiry |
SAP053A-023-3482S | Recombinant Staphylococcus aureus (strain: NE 3890) SAP053A_023 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
IGHG4 -23H | Native Human IgG4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS18-397HCL | Recombinant Human VPS18 293 Cell Lysate | +Inquiry |
CD302-1172RCL | Recombinant Rat CD302 cell lysate | +Inquiry |
C9-7945HCL | Recombinant Human C9 293 Cell Lysate | +Inquiry |
RTN3-2122HCL | Recombinant Human RTN3 293 Cell Lysate | +Inquiry |
MIER3-4316HCL | Recombinant Human MIER3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ILVBL Products
Required fields are marked with *
My Review for All ILVBL Products
Required fields are marked with *
0
Inquiry Basket