Recombinant Human ILF3 Protein, GST-tagged

Cat.No. : ILF3-5160H
Product Overview : Human ILF3 full-length ORF ( AAH03086, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein was first discovered to be a subunit of the nuclear factor of activated T-cells (NFAT); a transcription factor required for T-cell expression of interleukin 2. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. These proteins have been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth; possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Molecular Mass : 43.12 kDa
AA Sequence : MCSCPISSPGHIKGLGQEETPVRSADLVFKERMPACNTHGEGHFLAPPAKYLQTLGRRLHSQHRTSLNSFRISDHHHVQVSECRPTTRDGFHPPALLQIHAAQQARAWREQLLSTAPLEPSPRSRSSPVLMMPSCCWPETVSQLQQDDTGFRNMWLSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ILF3 interleukin enhancer binding factor 3, 90kDa [ Homo sapiens ]
Official Symbol ILF3
Synonyms ILF3; interleukin enhancer binding factor 3, 90kDa; interleukin enhancer binding factor 3, 90kD; interleukin enhancer-binding factor 3; DRBP76; M phase phosphoprotein 4; MPHOSPH4; MPP4; NF90; NFAR 1; M-phase phosphoprotein 4; translational control protein 80; dsRNA binding protein NFAR-2/MPP4; nuclear factor associated with dsRNA; double-stranded RNA-binding protein, 76 kD; nuclear factor of activated T-cells 90 kDa; nuclear factor of activated T-cells, 90 kD; CBTF; DRBF; MMP4; NFAR; NF110; NF90a; NF90b; NFAR2; TCP80; NF110b; NFAR-1; TCP110; NF-AT-90;
Gene ID 3609
mRNA Refseq NM_001137673
Protein Refseq NP_001131145
MIM 603182
UniProt ID Q12906

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ILF3 Products

Required fields are marked with *

My Review for All ILF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon