Recombinant Human ILF2, His-tagged
Cat.No. : | ILF2-29033TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 25-390 of Human ILF2 with an N terminal His tag; Predicted MWt 41kDa. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 25-390 a.a. |
Description : | Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDL APNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEV RQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILIT TVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNN PTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESG NFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQ EGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEE EENTEEPPQGEEEESMETQE |
Sequence Similarities : | Contains 1 DZF domain. |
Gene Name | ILF2 interleukin enhancer binding factor 2, 45kDa [ Homo sapiens ] |
Official Symbol | ILF2 |
Synonyms | ILF2; interleukin enhancer binding factor 2, 45kDa; interleukin enhancer binding factor 2, 45kD; interleukin enhancer-binding factor 2; NF45; |
Gene ID | 3608 |
mRNA Refseq | NM_004515 |
Protein Refseq | NP_004506 |
MIM | 603181 |
Uniprot ID | Q12905 |
Chromosome Location | 1q21.3 |
Function | ATP binding; DNA binding; double-stranded RNA binding; protein binding; transferase activity; |
◆ Recombinant Proteins | ||
MCR_0078-82M | Recombinant Moraxella catarrhalis MCR_0078 Protein | +Inquiry |
BRD9-10H | Recombinant Human BRD9 protein(Asp21-Glu540), His-tagged | +Inquiry |
Sdhc-1760M | Recombinant Mouse Sdhc protein, His & GST-tagged | +Inquiry |
ABCB1A-1089M | Recombinant Mouse ABCB1A Protein | +Inquiry |
COPS2-971R | Recombinant Rhesus monkey COPS2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
EDN3-8304H | Native Human EDN3 | +Inquiry |
Protein C-89H | Native Human Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDB2-4791HCL | Recombinant Human LDB2 293 Cell Lysate | +Inquiry |
HNRNPUL1-805HCL | Recombinant Human HNRNPUL1 cell lysate | +Inquiry |
CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
Ileum-574M | MiniPig Small Ileum Lysate, Total Protein | +Inquiry |
RENBP-537HCL | Recombinant Human RENBP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ILF2 Products
Required fields are marked with *
My Review for All ILF2 Products
Required fields are marked with *
0
Inquiry Basket