Recombinant Human IL7R Protein, C-His-tagged

• Cat.No.: IL7R-071H
• Product Overview: Recombinant Human IL7R Protein with C-His tag was expressed in E. coli.

Specification

• Description: Interleukin 7 (IL-7) was originally described as a factor capable of inducing in vitro proliferation of pre-B cells from marrow cultures. The IL-7 gene encodes a protein 177 amino acids in length. IL-7 exerts its biological function through the IL-7 receptor which is expressed on pre-B cells, thymocytes and bone marrow-derived macrophages. The IL-7 receptor is composed of an IL-7 receptor-specific chain and the IL-2 receptor γ chain common to the IL-2, IL-4, IL-7, IL-9 and IL-15 receptors. IL-7 stimulation leads to the activation of Janus tyrosine kinase family members JAK1 and JAK3. Other studies have shown that in T cells, the IL-7 receptor-specific chain associates with the Src kinases family Lck and Fyn. IL-7 induces phosphorylation of insulin receptor substrate-1 (IRS-1) and Insulin receptor substrate-2 (IRS-2), originally called 4PS.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~24 kDa
• AA Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: IL7R interleukin 7 receptor [ Homo sapiens (human) ]
• Official Symbol: IL7R
• Synonyms: IL7R; interleukin 7 receptor; interleukin-7 receptor subunit alpha; CD127; IL-7RA; CD127 antigen; IL-7R subunit alpha; IL-7 receptor subunit alpha; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; ILRA; IL7RA; CDW127; IL-7R-alpha
• Gene ID: 3575
• mRNA Refseq: NM_002185
• Protein Refseq: NP_002176
• MIM: 146661
• UniProt ID: P16871