Recombinant Full Length Horse Interleukin-7 Receptor Subunit Alpha(Il7R) Protein, His-Tagged
Cat.No. : | RFL8109EF |
Product Overview : | Recombinant Full Length Horse Interleukin-7 receptor subunit alpha(IL7R) Protein (A0MSX9) (21-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-458) |
Form : | Lyophilized powder |
AA Sequence : | ESGYAQNGDFEDAELDDYSFSCYSQLEVDGPQHLLSCAFEDPDVNSTNLEFEICEGLLEVKCLNFSKLQETYFIKTKKFLLIGDSTICVKLGGKHITCQKLNIVKRVKPEAPFDVKVIYREEANEFVVTFNTSHLQKKYVKDLLHEVVYRLEKNENDWMHVNISSTKLTLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEWSPSSHFRTPENNSGKMDPVLLIISIVSFFSVALMVILACVLWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPESFLDCQIHKVDGIQARDEAEAFLQDTFPPQLDDSEKQRLGGGVQGLNWPSQHAVITPKTFGGESPLRCLSGSVTVCDVPVIPSSRPPDCREGGKNGPHVYQGLLLGAGTTNSTLPHLFPFQSGILTLNPAVQGQPLFTSLGSSQEEAYVTMSSFYQNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IL7R |
Synonyms | IL7R; Interleukin-7 receptor subunit alpha; IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA; CD antigen CD127 |
UniProt ID | A0MSX9 |
◆ Recombinant Proteins | ||
Il7r-2233M | Recombinant Mouse Il7r protein, His-tagged | +Inquiry |
IL7R-0304H | Active Recombinant Human IL7R protein, mFc-tagged | +Inquiry |
IL7R-2260H | Recombinant Human IL7R protein, His-tagged | +Inquiry |
Il7r-5453M | Recombinant Mouse Il7r protein, His-tagged | +Inquiry |
IL7R-367C | Recombinant Cynomolgus Monkey IL7R Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7R-959RCL | Recombinant Rat IL7R cell lysate | +Inquiry |
IL7R-2473MCL | Recombinant Mouse IL7R cell lysate | +Inquiry |
IL7R-2595HCL | Recombinant Human IL7R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7R Products
Required fields are marked with *
My Review for All IL7R Products
Required fields are marked with *
0
Inquiry Basket