Recombinant Full Length Human IL7 Protein, GST-tagged

• Cat.No.: IL7-5695HF
• Product Overview: Human IL7 full-length ORF ( AAH47698, 26 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 26-177 amino acids
• Description: The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. [provided by RefSeq
• Molecular Mass: 42.46 kDa
• AA Sequence: DCDIEGKDGKQYESVLVVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IL7 interleukin 7 [ Homo sapiens ]
• Official Symbol: IL7
• Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880
• Protein Refseq: NP_000871
• MIM: 146660
• UniProt ID: P13232