Recombinant Human IL6ST Protein, GST-tagged
Cat.No. : | IL6ST-5171H |
Product Overview : | Human IL6ST partial ORF ( NP_002175, 23 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor) [ Homo sapiens ] |
Official Symbol | IL6ST |
Synonyms | IL6ST; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin-6 receptor subunit beta; CD130; GP130; CD130 antigen; IL-6R subunit beta; membrane glycoprotein 130; IL-6 receptor subunit beta; membrane glycoprotein gp130; interleukin receptor beta chain; oncostatin-M receptor subunit alpha; gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form; CDW130; IL-6RB; DKFZp564F053; |
Gene ID | 3572 |
mRNA Refseq | NM_001190981 |
Protein Refseq | NP_001177910 |
MIM | 600694 |
UniProt ID | P40189 |
◆ Recombinant Proteins | ||
IL6ST-6434C | Recombinant Chicken IL6ST | +Inquiry |
IL6ST-225R | Recombinant Rhesus IL6ST protein, His-tagged | +Inquiry |
Il6st-789M | Recombinant Mouse Il6st protein, His & T7-tagged | +Inquiry |
IL6ST-2750H | Recombinant Human IL6ST protein(691-860 aa), C-His-tagged | +Inquiry |
IL6ST-1300H | Active Recombinant Human IL6ST protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6ST-001MCL | Recombinant Mouse IL6ST cell lysate | +Inquiry |
IL6ST-935HCL | Recombinant Human IL6ST cell lysate | +Inquiry |
IL6ST-1882RCL | Recombinant Rat IL6ST cell lysate | +Inquiry |
IL6ST-946CCL | Recombinant Cynomolgus IL6ST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6ST Products
Required fields are marked with *
My Review for All IL6ST Products
Required fields are marked with *
0
Inquiry Basket