Recombinant human IL6, Active, His-tagged
Cat.No. : | IL6-1558H |
Product Overview : | Recombinant human Interleukin-6 is a polypeptide chain containing 183 amino acids (30 – 212 of P05231 IL6_HUMAN) and 10 aa Histidine-based tag. It as a predicted molecular mass of 22.2 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 23-24 kDa in SDS-PAGE gel. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Protein Length : | 30-212 a.a. |
Description : | Recombinant human Interleukin-6 is an important pro-inflammatory and anti-inflammatory cytokine expressed by many types cell including: T and B cells, macrophages, endothelial cells, fibroblasts, monocytes, keratinocytes and certain tumour cells. It is a multifunctional cytokine that modulates several physiologic processes such as haematopoiesis, stimulation of immunoglobulin synthesis, maturation and activation of B cells, differentiation of T lymphocytes and regulation of the hepatic acute-phase response. IL-6 is also produced in muscle, is discharged into the bloodstream after muscle contraction and acts increasing the breakdown of fats and improving insulin resistance. IL-6 induces signalling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL-6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signalling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130-expressing cells that lack cell surface IL-6 R. Trans-signalling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. |
Form : | Recombinant human IL-6 is lyophilized from 10mM Phosphate Potasium buffer pH 7.4 and 50mM NaCl. |
Molecular Mass : | Predicted molecular mass of 22.2 kDa, could migrate with an apparent molecular mass of 23-24 kDa in SDS-PAGE gel. |
AA Sequence : | HHHHHHHHHHVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPK MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDP TTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |
Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ] |
Official Symbol | IL6 |
Synonyms | IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6; |
Gene ID | 3569 |
mRNA Refseq | NM_000600 |
Protein Refseq | NP_000591 |
MIM | 147620 |
UniProt ID | P05231 |
Chromosome Location | 7p21-p15 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; |
Function | cytokine activity; cytokine activity; growth factor activity; interleukin-6 receptor binding; contributes_to interleukin-6 receptor binding; interleukin-6 receptor binding; |
◆ Native Proteins | ||
IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
0
Inquiry Basket