Recombinant Human IL3RA

Cat.No. : IL3RA-440H
Product Overview : Human IL3RA full-length ORF (NP_002174.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 43.3 kDa
AA Sequence : MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
Official Symbol IL3RA
Synonyms IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra
Gene ID 3563
mRNA Refseq NM_002183
Protein Refseq NP_002174
MIM 308385
UniProt ID P26951

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL3RA Products

Required fields are marked with *

My Review for All IL3RA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon