Recombinant Human IL36RN Protein, GST-tagged
Cat.No. : | IL36RN-5185H |
Product Overview : | Human IL36RN full-length ORF ( NP_036407.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq |
Molecular Mass : | 43.4 kDa |
AA Sequence : | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL36RN interleukin 36 receptor antagonist [ Homo sapiens ] |
Official Symbol | IL36RN |
Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
Gene ID | 26525 |
mRNA Refseq | NM_012275 |
Protein Refseq | NP_036407 |
MIM | 605507 |
UniProt ID | Q9UBH0 |
◆ Recombinant Proteins | ||
IL36RN-596H | Recombinant Human interleukin 36 receptor antagonist, His-tagged | +Inquiry |
IL1F5-237B | Recombinant Bovine Interleukin 1 Family, Member 5 (Delta) | +Inquiry |
IL36RN-3479H | Recombinant Human IL36RN Protein (Lys12-Phe151), N-His tagged | +Inquiry |
IL36RN-5185H | Recombinant Human IL36RN Protein, GST-tagged | +Inquiry |
IL36RN-152H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *
0
Inquiry Basket