Recombinant Human IL36B protein, His-tagged

• Cat.No.: IL36B-7519H
• Product Overview: Recombinant Human IL36B protein(NP_055253)(1-157 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-157 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IL36B interleukin 36, beta [ Homo sapiens ]
• Official Symbol: IL36B
• Synonyms: IL36B; interleukin 36, beta; IL1F8, interleukin 1 family, member 8 (eta); interleukin-36 beta; FIL1; FILI (ETA); IL 1F8; IL 1H2; IL1 ETA; IL1H2; MGC126880; MGC126882; FIL1 eta; IL-1 eta; IL-1F8 (FIL1-eta); interleukin-1 eta; interleukin 1, eta; interleukin-1 homolog 2; Interleukin-1 Superfamily e; family of interleukin 1-eta; interleukin-1 family member 8; IL1F8 (Canonical product IL-1F8a); interleukin 1 family, member 8 (eta); FIL1H; IL1F8; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA)
• Gene ID: 27177
• mRNA Refseq: NM_014438.3
• Protein Refseq: NP_055253
• MIM: 605508
• UniProt ID: Q9NZH7