Recombinant Active Human IL36B Protein, His-tagged(C-ter)

• Cat.No.: IL36B-197H
• Product Overview: Recombinant Active Human IL36B Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 0.2 ng/mL.
• AA Sequence: MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL36B interleukin 36, beta [ Homo sapiens ]
• Official Symbol: IL36B
• Synonyms: IL36B; interleukin 36, beta; IL1F8, interleukin 1 family, member 8 (eta); interleukin-36 beta; FIL1; FILI (ETA); IL 1F8; IL 1H2; IL1 ETA; IL1H2; MGC126880; MGC126882; FIL1 eta; IL-1 eta; IL-1F8 (FIL1-eta); interleukin-1 eta; interleukin 1, eta; interleukin-1 homolog 2; Interleukin-1 Superfamily e; family of interleukin 1-eta; interleukin-1 family member 8; IL1F8 (Canonical product IL-1F8a); interleukin 1 family, member 8 (eta); FIL1H; IL1F8; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA)
• Gene ID: 27177
• mRNA Refseq: NM_014438
• Protein Refseq: NP_055253
• MIM: 605508
• UniProt ID: Q9NZH7