Recombinant Human IL32 Protein, His tagged

• Cat.No.: IL32-20H

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-131 aa
• Description: This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Molecular Mass: 22 kDa
• AA Sequence: MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRG
• Endotoxin: Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1 EU/μg).
• Purity: > 95%, as determined by SDS-PAGE and HPLC
• Usage: This product is for research purposes only. It may not be used for therapeutics or diagnostic purposes.
• Storage: The lyophilized protein is stable for at least 2 years from date of receipt at -20 centigrade.
• Storage Buffer: Recombinant IL32 was lyophilized from 0.2 μm filtered PBS solution pH7.4
• Reconstitution: A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 0.1 mg/mL. This solution can then be diluted into other buffers.

Gene Information

• Gene Name: IL32 interleukin 32 [ Homo sapiens (human) ]
• Official Symbol: IL32
• Synonyms: IL32; interleukin 32; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma; interleukin-32; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cell transcript 4; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor
• Gene ID: 9235
• mRNA Refseq: www.ncbi.nlm.nih.gov/nuccore/NM_004221.7
• Protein Refseq: www.ncbi.nlm.nih.gov/protein/NP_004212.4
• MIM: 606001
• UniProt ID: F8W1V1