Recombinant Human IL29 protein
Cat.No. : | IL29-100H |
Product Overview : | Recombinant Human IL29 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 181 |
Description : | IL-28A, IL-28B, and IL-29, also named interferon-λ2 (IFN-λ2), IFN-λ3, and IFN-λ1, respectively, are newly identified class II cytokine receptor ligands that are distantly related to members of the IL-10 family (11-13 % a.a. sequence identity) and the type I IFN family (15-19 % a.a. sequence identity). The expression of IL-28A, B, and IL-29 is induced by virus infection or double-stranded RNA. All three cytokines exert bioactivities that overlap those of type I IFNs, including antiviral activity and up-regulation of MHC class I antigen expression. The three proteins signal through the same heterodimeric receptor complex that is composed of the IL-10 receptor β (IL-10 Rβ) and a novel IL-28 receptor α (IL-28 Rα, also known as IFN-λR1). Ligand binding to the receptor complex induces Jak kinase activation and STAT1 and STAT2 tyrosine phosphorylation. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 19.8 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids. |
AA Sequence : | GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
Endotoxin : | Less than 1 EU/μg of rHuIFN-λ1/IL-29 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL29 |
Official Symbol | IL29 |
Synonyms | IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29; |
Gene ID | 282618 |
mRNA Refseq | NM_172140 |
Protein Refseq | NP_742152 |
MIM | 607403 |
UniProt ID | Q8IU54 |
◆ Recombinant Proteins | ||
IL29-513H | Recombinant Human IL29 Protein | +Inquiry |
IL29-4621H | Recombinant Human IL29 protein, His-SUMO-tagged | +Inquiry |
IL29-131H | Active Recombinant Human IL29 Protein (Pro23-Thr200), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL29-34H | Active Recombinant Human IL29 Protein, Animal Free | +Inquiry |
IL29-002H | Active Recombinant Human IL29, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL29-5228HCL | Recombinant Human IL29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL29 Products
Required fields are marked with *
My Review for All IL29 Products
Required fields are marked with *
0
Inquiry Basket