Recombinant Human IL22, StrepII-tagged

• Cat.No.: IL22-215H
• Product Overview: Purified, full-length human recombinant Interleukin 22 or IL22 protein (amino acids 34-179, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.7 kDa. (Accession NP_065386.1; UniProt Q9GZX6)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 34-179, 146 a.a.
• Description: IL22 acts primarily on epithelial cells and is involved in inflammatory response. The cytokine induces multiple signaling pathways that help prevent tissue damage during inflammation. IL22 levels are often up-regulated in many chronic inflammatory conditions. This protein is a member of IL10 family.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQS DRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL22 interleukin 22 [ Homo sapiens ]
• Official Symbol: IL22
• Synonyms: IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23
• Gene ID: 50616
• mRNA Refseq: NM_020525
• Protein Refseq: NP_065386
• MIM: 605330
• UniProt ID: Q9GZX6
• Chromosome Location: 12q15
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity; interleukin-22 receptor binding