Recombinant Human IL22, StrepII-tagged
Cat.No. : | IL22-215H |
Product Overview : | Purified, full-length human recombinant Interleukin 22 or IL22 protein (amino acids 34-179, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.7 kDa. (Accession NP_065386.1; UniProt Q9GZX6) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 34-179, 146 a.a. |
Description : | IL22 acts primarily on epithelial cells and is involved in inflammatory response. The cytokine induces multiple signaling pathways that help prevent tissue damage during inflammation. IL22 levels are often up-regulated in many chronic inflammatory conditions. This protein is a member of IL10 family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQS DRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | IL22 interleukin 22 [ Homo sapiens ] |
Official Symbol | IL22 |
Synonyms | IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23; |
Gene ID | 50616 |
mRNA Refseq | NM_020525 |
Protein Refseq | NP_065386 |
MIM | 605330 |
UniProt ID | Q9GZX6 |
Chromosome Location | 12q15 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine activity; interleukin-22 receptor binding; |
◆ Recombinant Proteins | ||
IL22-91H | Recombinant Human IL22 Protein, His-tagged | +Inquiry |
IL22-73H | Recombinant Human IL22 Protein | +Inquiry |
IL22-2926Z | Recombinant Zebrafish IL22 | +Inquiry |
IL22-163H | Recombinant Human IL22 Protein | +Inquiry |
IL22-561H | Active Recombinant Human IL22, MIgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *
0
Inquiry Basket