Recombinant Human IL22 protein, His-tagged
Cat.No. : | IL22-2743H |
Product Overview : | Recombinant Human IL22 protein(28-179 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-179 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Gene Name | IL22 interleukin 22 [ Homo sapiens ] |
Official Symbol | IL22 |
Synonyms | IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23; |
Gene ID | 50616 |
mRNA Refseq | NM_020525 |
Protein Refseq | NP_065386 |
MIM | 605330 |
UniProt ID | Q9GZX6 |
◆ Recombinant Proteins | ||
ADAD2-275C | Recombinant Cynomolgus ADAD2 Protein, His-tagged | +Inquiry |
ADAD2-842HF | Recombinant Full Length Human ADAD2 Protein, GST-tagged | +Inquiry |
ADAD2-270H | Recombinant Human ADAD2 Protein, GST-tagged | +Inquiry |
ADAD2-25C | Recombinant Cynomolgus Monkey ADAD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL22-2743H | Recombinant Human IL22 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAD2-1000HCL | Recombinant Human ADAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAD2 Products
Required fields are marked with *
My Review for All ADAD2 Products
Required fields are marked with *
0
Inquiry Basket