Recombinant Human IL22 protein

• Cat.No.: IL22-135H
• Product Overview: Recombinant Human IL22 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 147
• Description: IL-22 is belonging to IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes and dendritic cells, IL-10 contributes to the inflammatory response in vivo. IL-22 signals through CRF2-4 and IL-22. It along with IL-17 is rapidly produced by splenic LTi-like cells and can be also produced by Th17 cells and likely plays a role in the coordinated response of both adaptive and innate immune systems.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 5.0.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 × 10⁶ IU/mg.
• Molecular Mass: Approximately 33.6 kDa, non-disulfide-linked homodimeric protein containing of two 147 amino acid polypeptide chains.
• AA Sequence: MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
• Endotoxin: Less than 1 EU/µg of rHuIL-22 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL22
• Official Symbol: IL22
• Synonyms: IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23
• Gene ID: 50616
• mRNA Refseq: NM_020525
• Protein Refseq: NP_065386
• MIM: 605330
• UniProt ID: Q9GZX6