Recombinant Human IL20RB Protein, Fc-tagged
Cat.No. : | IL20RB-324H |
Product Overview : | Recombinant human IL20RB protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 311 |
Description : | IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]). |
Form : | Lyophilized |
Molecular Mass : | 49.1 kDa |
AA Sequence : | MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL20RB interleukin 20 receptor beta [ Homo sapiens (human) ] |
Official Symbol | IL20RB |
Synonyms | IL20RB; interleukin 20 receptor beta; fibronectin type III domain containing 6 , FNDC6; interleukin-20 receptor subunit beta; DIRS1; IL 20R2; MGC34923; IL-20RB; IL-20R-beta; interleukin-20 receptor II; IL-20 receptor subunit beta; fibronectin type III domain containing 6; FNDC6; IL-20R2; |
Gene ID | 53833 |
mRNA Refseq | NM_144717 |
Protein Refseq | NP_653318 |
MIM | 605621 |
UniProt ID | Q6UXL0 |
◆ Recombinant Proteins | ||
IL20RB-4551H | Recombinant Human IL20RB protein, His-tagged | +Inquiry |
IL20RB-2243R | Recombinant Rhesus monkey IL20RB Protein, His-tagged | +Inquiry |
IL20RB-5655H | Active Recombinant Human IL20RB Protein, Fc-tagged | +Inquiry |
IL20RB-3669H | Recombinant Human IL20RB Protein (Ala37-Glu290), N-His tagged | +Inquiry |
IL20RB-762H | Recombinant Human IL20RB | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL20RB-1495RCL | Recombinant Rat IL20RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL20RB Products
Required fields are marked with *
My Review for All IL20RB Products
Required fields are marked with *
0
Inquiry Basket