Recombinant Human IL20RA Protein, Fc-tagged
Cat.No. : | IL20RA-969H |
Product Overview : | Recombinant Human IL20RA fused with Fc tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a member of the type II cytokine receptor family. The encoded protein is a subunit of the receptor for interleukin 20, a cytokine that may be involved in epidermal function. The interleukin 20 receptor is a heterodimeric complex consisting of the encoded protein and interleukin 20 receptor beta. This gene and interleukin 20 receptor beta are highly expressed in skin, and are upregulated in psoriasis. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 26.3kD |
AA Sequence : | VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IL20RA interleukin 20 receptor, alpha [ Homo sapiens ] |
Official Symbol | IL20RA |
Synonyms | IL20RA; interleukin 20 receptor, alpha; interleukin-20 receptor subunit alpha; IL 20R1; ZCYTOR7; CRF2-8; IL-20RA; IL-20R-alpha; interleukin-20 receptor I; IL-20 receptor subunit alpha; class II cytokine receptor ZCYTOR7; cytokine receptor class-II member 8; cytokine receptor family 2 member 8; IL-20R1; FLJ40993; |
Gene ID | 53832 |
mRNA Refseq | NM_014432 |
Protein Refseq | NP_055247 |
MIM | 605620 |
UniProt ID | Q9UHF4 |
◆ Recombinant Proteins | ||
IL20RA-4505M | Recombinant Mouse IL20RA Protein, His (Fc)-Avi-tagged | +Inquiry |
IL20RA-968H | Recombinant Human IL20RA Protein, His-tagged | +Inquiry |
IL20RA-4884Z | Recombinant Zebrafish IL20RA | +Inquiry |
Il20ra-1326M | Recombinant Mouse Il20ra protein, His-tagged | +Inquiry |
Il20ra-6744M | Recombinant Mouse Il20ra protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL20RA-2720HCL | Recombinant Human IL20RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL20RA Products
Required fields are marked with *
My Review for All IL20RA Products
Required fields are marked with *
0
Inquiry Basket