Recombinant Human IL1F10 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: IL1F10-669H
• Product Overview: IL1F10 MS Standard C13 and N15-labeled recombinant protein (NP_115945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses. Two alternatively spliced transcript variants encoding the same protein have been reported.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17 kDa
• AA Sequence: MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IL1F10 interleukin 1 family member 10 [ Homo sapiens (human) ]
• Official Symbol: IL1F10
• Synonyms: IL1F10; interleukin 1 family, member 10 (theta); interleukin-1 family member 10; FIL1 theta; FKSG75; IL 1F10; IL 1HY2; IL1 theta; interleukin 1 receptor antagonist FKSG75; MGC11983; MGC119832; MGC119833; FIL1 theta; IL-1 theta; interleukin-1 HY2; interleukin-1 theta; IL-1F10 (canonical form IL-1F10a); interleukin-1 receptor antagonist FKSG75; interleukin-1 receptor antagonist-like FIL1 theta; IL-1HY2; IL1-theta; FIL1-theta; MGC119831
• Gene ID: 84639
• mRNA Refseq: NM_032556
• Protein Refseq: NP_115945
• MIM: 615296
• UniProt ID: Q8WWZ1