Recombinant Human IL19 Protein
Cat.No. : | IL19-146H |
Product Overview : | Recombinant Human IL19 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-a) expression in monocytes, and promotes T helper 2 (Th2) cell-mediated immune responses. IL-19 production is up-regulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 17.9 kDa (154 aa) |
AA Sequence : | MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL19 interleukin 19 [ Homo sapiens (human) ] |
Official Symbol | IL19 |
Synonyms | IL19; interleukin 19; interleukin-19; IL 10C; IL 19; MDA1; melanoma differentiation associated protein like protein; NG.1; ZMDA1; melanoma differentiation associated protein-like protein; melanoma differentiation-associated protein-like protein; IL-10C; |
Gene ID | 29949 |
mRNA Refseq | NM_013371 |
Protein Refseq | NP_037503 |
MIM | 605687 |
UniProt ID | Q9UHD0 |
◆ Recombinant Proteins | ||
IL19-138H | Active Recombinant Human IL19 Protein (Leu25-Ala177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL19-130H | Recombinant Human IL19 protein | +Inquiry |
IL19-146H | Recombinant Human IL19 Protein | +Inquiry |
IL19-151H | Recombinant Human IL19 Protein, His-tagged | +Inquiry |
IL19-4438H | Recombinant Human IL19 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL19 Products
Required fields are marked with *
My Review for All IL19 Products
Required fields are marked with *
0
Inquiry Basket