Recombinant Human IL18BP Protein, His-tagged
Cat.No. : | IL18BP-315H |
Product Overview : | Recombinant human IL18BP protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 194 |
Description : | The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Lyophilized |
Molecular Mass : | 18.5 kDa |
AA Sequence : | MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL18BP interleukin 18 binding protein [ Homo sapiens (human) ] |
Official Symbol | IL18BP |
Synonyms | IL18BP; interleukin 18 binding protein; interleukin-18-binding protein; IL18BPa; MC51L 53L 54L homolog gene product; IL-18BP; tadekinig-alfa; MC51L-53L-54L homolog gene product; |
Gene ID | 10068 |
mRNA Refseq | NM_001039659 |
Protein Refseq | NP_001034748 |
MIM | 604113 |
UniProt ID | O95998 |
◆ Recombinant Proteins | ||
IL18BP-2683H | Active Recombinant Human IL18BP protein, hFc&His-tagged | +Inquiry |
IL18BP-342H | Active Recombinant Human IL18BP protein, His-tagged | +Inquiry |
Il18bp-142M | Recombinant Mouse Il18bp Protein, His (Fc)-Avi-tagged | +Inquiry |
IL18BP-1656H | Recombinant Human Interleukin 18 Binding Protein | +Inquiry |
IL18BP-7240H | Recombinant Human IL18BP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18BP-2674MCL | Recombinant Mouse IL18BP cell lysate | +Inquiry |
IL18BP-2918HCL | Recombinant Human IL18BP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL18BP Products
Required fields are marked with *
My Review for All IL18BP Products
Required fields are marked with *
0
Inquiry Basket