Recombinant Human IL15 Protein, GMP Grade, Animal-Free

• Cat.No.: IL15-35HG
• Product Overview: GMP Recombinant Human IL15 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Description: IL-15 is an immunomodulating cytokine that stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. IL-15 exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells.
• AA Sequence: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens (human) ]
• Official Symbol: IL15
• Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15
• Gene ID: 3600
• mRNA Refseq: NM_000585
• Protein Refseq: NP_000576
• MIM: 600554
• UniProt ID: P40933