Recombinant Human IL15, StrepII-tagged

• Cat.No.: IL15-270H
• Product Overview: Purified, full-length human recombinant IL15 protein (amino acids 30-162, 133 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 14.7 kDa. (Accession NP_000576; UniProt P40933)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 30-162, 133 a.a.
• Description: IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. IL15 and IL2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other"s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: GIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGD ASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens ]
• Official Symbol: IL15
• Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15
• Gene ID: 3600
• mRNA Refseq: NM_000585
• Protein Refseq: NP_000576
• MIM: 600554
• UniProt ID: P40933
• Chromosome Location: 4q31
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: cytokine activity; cytokine receptor binding; protein binding