Recombinant Human IL13RA2 protein

• Cat.No.: IL13RA2-3829H
• Product Overview: Recombinant Human IL13RA2 was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 44.2 kDa
• AA Sequence: MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRN IGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKVQDMDCVYYNW QYLLCSWKPGIGVLLDTNYNLFYWYEGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRS SYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTGLLLRKPNTYPKMIPE FFCDT
• Applications: Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
• Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ]
• Official Symbol: IL13RA2
• Synonyms: IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP; IL-13RA2; IL-13R-alpha-2; IL-13R subunit alpha-2; IL-13 receptor subunit alpha-2; interleukin 13 binding protein; interleukin-13-binding protein; interleukin 13 receptor alpha 2 chain; IL-13R; CD213A2
• Gene ID: 3598
• mRNA Refseq: NM_000640
• Protein Refseq: NP_000631
• MIM: 300130
• UniProt ID: Q14627
• Chromosome Location: Xq13.1-q28
• Pathway: IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine receptor activity; receptor activity; signal transducer activity