Recombinant Human IL13RA2

• Cat.No.: IL13RA2-28498TH
• Product Overview: Recombinant fragment of Human IL13 receptor alpha 2 with N terminal proprietary tag, 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
• Sequence Similarities: Belongs to the type I cytokine receptor family. Type 5 subfamily.Contains 1 fibronectin type-III domain.

Gene Information

• Gene Name: IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ]
• Official Symbol: IL13RA2
• Synonyms: IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP
• Gene ID: 3598
• mRNA Refseq: NM_000640
• Protein Refseq: NP_000631
• MIM: 300130
• Uniprot ID: Q14627
• Chromosome Location: Xq13.1-q28
• Pathway: IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine receptor activity; receptor activity; signal transducer activity