Recombinant Human IL13 protein, hFc-tagged
Cat.No. : | IL13-4325H |
Product Overview : | Recombinant Human IL13 protein(P35225)(25-146aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 25-146aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | IL13 interleukin 13 [ Homo sapiens ] |
Official Symbol | IL13 |
Synonyms | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13; |
Gene ID | 3596 |
mRNA Refseq | NM_002188 |
Protein Refseq | NP_002179 |
MIM | 147683 |
UniProt ID | P35225 |
◆ Recombinant Proteins | ||
IL13-2681R | Recombinant Rat IL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL13-3170C | Recombinant Cat IL13 protein(34-144aa), His-tagged | +Inquiry |
Il13-580R | Recombinant Rat Il13 protein | +Inquiry |
IL13-248H | Recombinant Human interleukin 13 Protein, Tag Free | +Inquiry |
IL13-120H | Recombinant Human IL13 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *
0
Inquiry Basket