Recombinant Human IL13
Cat.No. : | IL13-28497TH |
Product Overview : | Full length Human Recombinant IL13 is a single, non-glycosylated polypeptide chain containing 112 amino acids. M.Wt 12 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. |
Form : | Lyophilised:Reconstitutein sterile 18MOhm/cm water at not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS, pH 7.2 |
Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN. |
Sequence Similarities : | Belongs to the IL-4/IL-13 family. |
Full Length : | Full L. |
Gene Name | IL13 interleukin 13 [ Homo sapiens ] |
Official Symbol | IL13 |
Synonyms | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; |
Gene ID | 3596 |
mRNA Refseq | NM_002188 |
Protein Refseq | NP_002179 |
MIM | 147683 |
Uniprot ID | P35225 |
Chromosome Location | 5q31 |
Pathway | Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; |
Function | cytokine activity; interleukin-13 receptor binding; protein binding; |
◆ Recombinant Proteins | ||
IL13-60M | Recombinant Mouse IL-13 | +Inquiry |
IL13-50H | Active Recombinant Human Interleukin 13, MIgG2a Fc-tagged | +Inquiry |
IL13-1568C | Active Recombinant Cynomolgus IL13 protein, His-tagged | +Inquiry |
IL13-3026R | Recombinant Rat IL13 Protein | +Inquiry |
IL13-147H | Recombinant Human IL13 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *
0
Inquiry Basket