Recombinant Human IL12RB2 protein, His-tagged

• Cat.No.: IL12RB2-3884H
• Product Overview: Recombinant Human IL12RB2(24-622aa) fused with His tag was expressed in Yeast.

Specification

• Description: This protein is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohn s disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 69.7kD
• Protein length: 24-622aa
• AA Sequence: KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTL FVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQC KDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRD EGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTG MLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVS AANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNW LRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQE QMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKAN
• Purity: >90% ( SDS-PAGE )
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.

Gene Information

• Gene Name: IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
• Official Symbol: IL12RB2
• Synonyms: IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2; IL-12RB2; IL-12R-beta-2; IL-12 receptor beta 2; IL-12R subunit beta-2; IL-12 receptor subunit beta-2; interleukin-12 receptor beta-2 chain; RP11-102M16.1
• Gene ID: 3595
• mRNA Refseq: NM_001258214
• Protein Refseq: NP_001245143
• MIM: 601642
• UniProt ID: Q99665
• Chromosome Location: 1p31.3-p31.2
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine receptor activity; protein kinase binding; receptor activity