Recombinant Human IL12RB1 Protein, His-tagged
Cat.No. : | IL12RB1-074H |
Product Overview : | Recombinant Human IL12RB1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade. |
Molecular Mass : | ~52 kDa |
AA Sequence : | CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IL12RB1 interleukin 12 receptor, beta 1 [ Homo sapiens (human) ] |
Official Symbol | IL12RB1 |
Synonyms | IL12RB1; interleukin 12 receptor, beta 1; IL12RB; interleukin-12 receptor subunit beta-1; CD212; IL-12RB1; IL-12R-beta-1; IL-12R subunit beta-1; IL-12 receptor beta component; IL-12 receptor subunit beta-1; interleukin-12 receptor beta-1 chain; IL-12R-BETA1; MGC34454; |
Gene ID | 3594 |
mRNA Refseq | NM_005535 |
Protein Refseq | NP_005526 |
MIM | 601604 |
UniProt ID | P42701 |
◆ Recombinant Proteins | ||
Il12rb1-10576M | Recombinant Mouse Il12rb1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL12RB1-6332H | Recombinant Human IL12RB1 protein, hFc-Avi-tagged | +Inquiry |
IL12RB1-0229H | Active Recombinant Human IL12RB1 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
IL12RB1-1733H | Recombinant Human IL12RB1 protein, His-tagged | +Inquiry |
IL12RB1-3230H | Active Recombinant Human IL12RB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12RB1-2188HCL | Recombinant Human IL12RB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12RB1 Products
Required fields are marked with *
My Review for All IL12RB1 Products
Required fields are marked with *
0
Inquiry Basket